PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G014046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NF-YB
Protein Properties Length: 161aa    MW: 18078.1 Da    PI: 4.8931
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G014046.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB164.91e-5123117397
                 NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                           +++r+lPianv+rimk++lP nakisk+aket+qecvsef+sfvt+easdkc+re+rkt+ngdd++wala lGf+dy+ plk yl++yr
  HL.SW.v1.0.G014046.1  23 QDQRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFVSFVTGEASDKCRRERRKTVNGDDVCWALAALGFDDYAGPLKRYLHRYR 111
                           46799************************************************************************************ PP

                 NF-YB  92 elegek 97 
                           ele ++
  HL.SW.v1.0.G014046.1 112 ELEVDR 117
                           ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-4822156IPR009072Histone-fold
SuperFamilySSF471132.74E-3724130IPR009072Histone-fold
PfamPF008083.2E-262791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.3E-165573No hitNo description
PRINTSPR006152.3E-167492No hitNo description
PRINTSPR006152.3E-1693111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MDNLIGAGSS NNGSDGVDKL LDQDQRLLPI ANVGRIMKQI LPPNAKISKE AKETMQECVS  60
EFVSFVTGEA SDKCRRERRK TVNGDDVCWA LAALGFDDYA GPLKRYLHRY RELEVDRSSS  120
IINNNQENNN NSNLMVMRLN DENLRAFEDH GRRNDDDACQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4021112192Transcription factor HapC (Eurofung)
4g92_B1e-4021112192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082708.12e-65PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822489e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A067K7772e-65A0A067K777_JATCU; Uncharacterized protein
STRINGPOPTR_0008s22520.14e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-55nuclear factor Y, subunit B5